About Reibman & Weiner
brooklyn medical malpractice lawyers, reibman & weiner specialize in cerebral palsy, erbs palsy and other brain injuries
Employee Directory
Frequent questions about Reibman & Weiner
What is the email domain for Reibman & Weiner's?
The email domain for Reibman & Weiner is brooklynmedicalmalpracticelawyersfirm.com.
How can I check if Reibman & Weiner email addresses are validated?
Validating Reibman & Weiner email addresses can be accomplished using Tomba, a tool that simplifies the verification and cleaning of email lists automatically.
What are the key industries for Reibman & Weiner?
Reibman & Weiner operates within the law practice industry
How many employees does Reibman & Weiner have currently?
Reibman & Weiner has approximately 11-50
What are Reibman & Weiner social links?
Reibman & Weiner appears on
linkedin.
What is the geographical location of Reibman & Weiner's headquarters?
Reibman & Weiner is headquartered in
new york,
new york,
United States.
.
Browse companies
Our company index contains hundreds of thousands of businesses.
This page is protected by reCAPTCHA. The Google Privacy Policy and Terms of Service apply.