About the Company
Well Dawn Integrative Health offers holistic mental health care for women. Specializing in anxiety, depression, postpartum depression, stress, and more.
Company Details
Website & Contact
- Website:peaceofmindpsychiatricservicespllc.com
- Email Addresses Found: 1 verified contacts View all email addresses
Email Database Statistics
- Total Email Addresses: 1 contacts Complete database of professional emails
- Personal Email Addresses: 1 individual contacts Direct employee email addresses
Domain Registration Details
- Domain Registrant: GoDaddy.com, LLC
- Registration Date: June 14th 2022, 03:24:08 pm
- Domain Registrar: http://www.godaddy.com
Discover All Email Addresses for the Domain
Use our domain search tool to find professional email addresses from peaceofmindpsychiatricservicespllc.com. Furthermore, our comprehensive database helps you connect with the right people at Peaceofmindpsychiatricservicespllc.com.
Try it free - Find up to 10 email addresses at no cost!
Give it a quick try with zapier.com.
Email Data Sources
All email addresses are sourced from publicly available information using our TombaWebPublic crawler. Additionally, we maintain transparency by showing exactly where each email was discovered.
Total verified sources: 1
Source URL | Date Discovered |
---|---|
https://tomba.io/robot |