About Vishwa Transcription Services
vishwa provides all kind of medical transcription services from orthodox transcription to platform based online transcription to v-ehr to hospitals, clinics and physicians in the u.s... Read more
Contact profiles Vishwa Transcription Services:
| Employee | Department | Total Email Source | |
|---|---|---|---|
 Vishwa Transcription | 1 | ||
 Rajashekaran Aaryes_rseditor | 0 | ||
 Sajeevkumar Somavallyviswanathane-transcription editor | 0 | ||
 Anish Voramedical transcription editor | 0 | ||
Vishwa Transcriptionmedical transcription | 0 | ||
Rohit Jambhulkarmts | 0 | ||
 Beena Wahab | 0 | ||
 Jijo Muthootsystem administrator | 0 | ||
Bichu Anandsenior medical transcriptionist - nuance india | 0 | ||
Rajesh Harisystem administrator and operations executive | 0 | ||
Ronald Antonyteam lead | 0 | ||
 Meeta Nairassistant manager- human resources | 0 | ||
Ruby Panickereditor | Software | 0 |
Vishwa Transcription Services Email Metrics
Vishwa Transcription Services has 16 email addresses.
Vishwa Transcription Services has 12 personal email addresses, .
Vishwa Transcription Services has 4 generic email addresses.
Email Finder
The Email Finder can find an email address with a good level of certainty. It either returns one we have in our base, or predicts one by analyzing the domain data.
Give it a shot. Find 3 email for free!
Not inspired? Try it with Mohamed from tomba.io.